Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcid ceramidase (AC)
LigandBDBM50392473
Substrate/Competitorn/a
Meas. Tech.ChEMBL_852177
IC50 1000±n/a nM
Citation Bhabak, KPArenz, C Novel amide- and sulfonamide-based aromatic ethanolamines: effects of various substituents on the inhibition of acid and neutral ceramidases. Bioorg Med Chem20:6162-70 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acid ceramidase (AC)
Name:Acid ceramidase
Synonyms:Acid ceramidase
Type:Enzyme
Mol. Mass.:44662.65
Organism:Homo sapiens (Human)
Description:Q13510
Residue:395
Sequence:
MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYK
RWHELMLDKAPVLKVIVNSLKNMINTFVPSGKIMQVVDEKLPGLLGNFPGPFEEEMKGIA
AVTDIPLGEIISFNIFYELFTICTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITE
QLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWI
LGKKDVMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKE
SLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLST
KPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50392473
NameBDBM50392473
Synonyms:CHEMBL429926
TypeSmall organic molecule
Emp. Form.C23H39NO2
Mol. Mass.361.5613
SMILESCCCCCCCCCCCCCC(=O)N[C@H](C)[C@@H](O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a