Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2
LigandBDBM50394720
Substrate/Competitorn/a
Meas. Tech.ChEMBL_858812
Ki 1.3±n/a nM
Citation Shook, BCRassnick, SWallace, NCrooke, JAult, MChakravarty, DBarbay, JKWang, APowell, MTLeonard, KAlford, VScannevin, RHCarroll, KLampron, LWestover, LLim, HKRussell, RBranum, SWells, KMDamon, SYouells, SLi, XBeauchamp, DARhodes, KJackson, PF Design and characterization of optimized adenosine A2A/A1 receptor antagonists for the treatment of Parkinson's disease. J Med Chem55:1402-17 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2
Name:Adenosine receptor
Synonyms:A2A adenosine receptor (hA2A) | ADENOSINE A2 | ADENOSINE A2a | ADORA2 | ADORA2A | Adenosine A2A receptor (A2AAR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44716.46
Organism:Homo sapiens (Human)
Description:P29274
Residue:412
Sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50394720
NameBDBM50394720
Synonyms:CHEMBL2165799
TypeSmall organic molecule
Emp. Form.C23H15FN4O
Mol. Mass.382.3898
SMILESNc1nc2-c3cc(Cc4cncc(F)c4)ccc3C(=O)c2c(n1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a