Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific demethylase 7B (KDM7B)
LigandBDBM50395079
Substrate/Competitorn/a
Meas. Tech.ChEMBL_859445
IC50 35000±n/a nM
Citation Rose, NRWoon, ECTumber, AWalport, LJChowdhury, RLi, XSKing, ONLejeune, CNg, SSKrojer, TChan, MCRydzik, AMHopkinson, RJChe, KHDaniel, MStrain-Damerell, CGileadi, CKochan, GLeung, IKDunford, JYeoh, KKRatcliffe, PJBurgess-Brown, Nvon Delft, FMuller, SMarsden, BBrennan, PEMcDonough, MAOppermann, UKlose, RJSchofield, CJKawamura, A Plant growth regulator daminozide is a selective inhibitor of human KDM2/7 histone demethylases. J Med Chem55:6639-43 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific demethylase 7B (KDM7B)
Name:Lysine-specific demethylase 7A/7B
Synonyms:Histone lysine demethylase PHF8 | Histone lysine demethylase PHF8 (PHF8) | Lysine-specific demethylase 7A/7B | PHD finger protein 8
Type:Protein
Mol. Mass.:117889.91
Organism:Homo sapiens (Human)
Description:Q9UPP1
Residue:1060
Sequence:
MNRSRAIVQRGRVLPPPAPLDTTNLAGRRTLQGRAKMASVPVYCLCRLPYDVTRFMIECD
MCQDWFHGSCVGVEEEKAADIDLYHCPNCEVLHGPSIMKKRRGSSKGHDTHKGKPVKTGS
PTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTV
RDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLV
ETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEK
IFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTP
VDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRE
NRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIF
QQNVGKTSNIFGLQRIFPAGSIPLTRPAHSTSVSMSRLSLPSKNGSKKKGLKPKELFKKA
ERKGKESSALGPAGQLSYNLMDTYSHQALKTGSFQKAKFNITGACLNDSDDDSPDLDLDG
NESPLALLMSNGSTKRVKSLSKSRRTKIAKKVDKARLMAEQVMEDEFDLDSDDELQIDER
LGKEKATLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDIEEDYTTDEDMVEGVEGKLGN
GSGAGGILDLLKASRQVGGPDYAALTEAPASPSTQEAIQGMLCMANLQSSSSSPATSSLQ
AWWTGGQDRSSGSSSSGLGTVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDS
LGACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGT
RVASIETGLAAAAAKLAQQELQKAQKKKYIKKKPLLKEVEQPRPQDSNLSLTVPAPTVAA
TPQLVTSSSPLPPPEPKQEALSGSLADHEYTARPNAFGMAQANRSTTPMAPGVFLTQRRP
SVGSQSNQAGQGKRPKKGLATAKQRLGRILKIHRNGKLLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50395079
NameBDBM50395079
Synonyms:CHEMBL2164244
TypeSmall organic molecule
Emp. Form.C7H15N2O3
Mol. Mass.175.2051
SMILESC[N+](C)(C)NC(=O)CCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a