Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific demethylase 7
LigandBDBM50395076
Substrate/Competitorn/a
Meas. Tech.ChEMBL_859443
IC50 2100±n/a nM
Citation Rose, NRWoon, ECTumber, AWalport, LJChowdhury, RLi, XSKing, ONLejeune, CNg, SSKrojer, TChan, MCRydzik, AMHopkinson, RJChe, KHDaniel, MStrain-Damerell, CGileadi, CKochan, GLeung, IKDunford, JYeoh, KKRatcliffe, PJBurgess-Brown, Nvon Delft, FMuller, SMarsden, BBrennan, PEMcDonough, MAOppermann, UKlose, RJSchofield, CJKawamura, A Plant growth regulator daminozide is a selective inhibitor of human KDM2/7 histone demethylases. J Med Chem55:6639-43 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific demethylase 7
Name:Lysine-specific demethylase 7
Synonyms:1.14.11.- | JHDM1D | JmjC domain-containing histone demethylation protein 1D | KDM7 | KIAA1718
Type:PROTEIN
Mol. Mass.:106577.86
Organism:Homo sapiens
Description:ChEMBL_859443
Residue:941
Sequence:
MAGAAAAVAAGAAAGAAAAAVSVAAPGRASAPPPPPPVYCVCRQPYDVNRFMIECDICKD
WFHGSCVGVEEHHAVDIDLYHCPNCAVLHGSSLMKKRRNWHRHDYTEIDDGSKPVQAGTR
TFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVM
DVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVE
VPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKI
FYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQ
DCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELRED
GFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEENG
KPVKSQGIPIVCPVSRSSNEATSPYHSRRKMRKLRDHNVRTPSNLDILELHTREVLKRLE
MCPWEEDILSSKLNGKFNKHLQPSSTVPEWRAKDNDLRLLLTNGRIIKDERQPFADQSLY
TADSENEEDKRRTKKAKMKIEESSGVEGVEHEESQKPLNGFFTRVKSELRSRSSGYSDIS
ESEDSGPECTALKSIFTTEESESSGDEKKQEITSNFKEESNVMRNFLQKSQKPSRSEIPI
KRECPTSTSTEEEAIQGMLSMAGLHYSTCLQRQIQSTDCSGERNSLQDPSSCHGSNHEVR
QLYRYDKPVECGYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRV
QSRNYVDSSGSSLQNGKYMQNSNLTSGACQISNGSLSPERPVGETSFSVPLHPTKRPASN
PPPISNQATKGKRPKKGMATAKQRLGKILKLNRNGHARFFV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50395076
n/a
NameBDBM50395076
Synonyms:CHEMBL2164243
TypeSmall organic molecule
Emp. Form.C6H12N2O3
Mol. Mass.160.1711
SMILESCN(C)NC(=O)CCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: