Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase I isoform alpha
LigandBDBM50395892
Substrate/Competitorn/a
Meas. Tech.ChEMBL_858046
Ki>1000000±n/a nM
Citation Tell, VHolzer, MHerrmann, LMahmoud, KASchächtele, CTotzke, FHilgeroth, A Multitargeted drug development: Discovery and profiling of dihydroxy substituted 1-aza-9-oxafluorenes as lead compounds targeting Alzheimer disease relevant kinases. Bioorg Med Chem Lett22:6914-8 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein kinase I isoform alpha
Name:Casein kinase I isoform alpha
Synonyms:CK1 | CKI-alpha | CSNK1A1 | Casein Kinase I | Casein kinase 1 alpha (CK1 alpha)
Type:Serine/threonine-protein kinase
Mol. Mass.:38936.59
Organism:Homo sapiens (Human)
Description:P48729
Residue:337
Sequence:
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50395892
NameBDBM50395892
Synonyms:CHEMBL2163772
TypeSmall organic molecule
Emp. Form.C17H11NO3
Mol. Mass.277.2741
SMILESOc1ccc2oc3ncc(O)c(-c4ccccc4)c3c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a