Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldo-keto reductase family 1 member C4 (AK1C4)
LigandBDBM50396662
Substrate/Competitorn/a
Meas. Tech.ChEMBL_864143
IC50>30000±n/a nM
Citation Jamieson, SMBrooke, DGHeinrich, DAtwell, GJSilva, SHamilton, EJTurnbull, APRigoreau, LJTrivier, ESoudy, CSamlal, SSOwen, PJSchroeder, ERaynham, TFlanagan, JUDenny, WA 3-(3,4-Dihydroisoquinolin-2(1H)-ylsulfonyl)benzoic Acids: highly potent and selective inhibitors of the type 5 17-ß-hydroxysteroid dehydrogenase AKR1C3. J Med Chem55:7746-58 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldo-keto reductase family 1 member C4 (AK1C4)
Name:Aldo-keto reductase family 1 member C4 (AK1C4)
Synonyms:3-alpha-HSD1 | 3-alpha-Hydroxysteroid Dehydrogenase Type 1 (AKR1C4) | 3-alpha-hydroxysteroid dehydrogenase type I | Aldo-keto reductase family 1 member C4 | CDR | Chlordecone reductase | DD-4 | DD4 | Dihydrodiol dehydrogenase 4 | HAKRA
Type:Enzyme
Mol. Mass.:37068.40
Organism:Homo sapiens (Human)
Description:P17516
Residue:323
Sequence:
MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPM
ALKPGETPLPKDENGKVIFDTVDLSATWEVMEKCKDAGLAKSIGVSNFNCRQLEMILNKP
GLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWVDPNSPVLLEDPV
LCALAKKHKQTPALIALRYQLQRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLN
RNYRYVVMDFLMDHPDYPFSDEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50396662
NameBDBM50396662
Synonyms:CHEMBL2172109
TypeSmall organic molecule
Emp. Form.C17H17NO4S
Mol. Mass.331.386
SMILESCC1N(CCc2ccccc12)S(=O)(=O)c1cccc(c1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a