Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcium-dependent protein kinase 4
LigandBDBM50345704
Substrate/Competitorn/a
Meas. Tech.ChEMBL_862298
IC50 177±n/a nM
Citation Rotella, DP Recent results in protein kinase inhibition for tropical diseases. Bioorg Med Chem Lett22:6788-93 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calcium-dependent protein kinase 4
Name:Calcium-dependent protein kinase 4
Synonyms:CDPK4 | CPK4
Type:PROTEIN
Mol. Mass.:60782.05
Organism:Plasmodium falciparum (isolate 3D7)
Description:ChEMBL_862298
Residue:528
Sequence:
MGQEVSSVNNTKNEHHKTNKKSLKGGNERHEMKESSVGISKKIVENSFNNSKLRPGMFIQ
NSNVVFNEQYKGIKILGKGSFGEVILSRDKHTGHEYAIKVISKKHVKRKTDKESLLREVE
LLKMLDHINIMKLYEFFEDNNYYYLVSDVYTGGELFDEIISRKRFYEIDAARIIKQILSG
ITYMHKNNVVHRDLKPENILLETKNKEDMIIKIIDFGLSTHFEYSKKMKDKIGTAYYIAP
DVLHGTYDEKCDIWSCGVILYILLSGCPPFNGSNEYDILKKVEAGKYTFDLPQFKKISDK
AKDLIKKMLMYTSAVRISARDALEHEWIKMMTSKDNLNIDIPSLELSIANIRQFQSTQKL
AQAALLYMGSKLTTIDETKELTKIFKKMDKNGDGQLDRNELIIGYKELLKLKGEDTSDLD
NAAIEYEVDQILNSIDLDQNGYIEYSEFLTVSIDRKLLLSTERLEKAFKLFDKDGSGKIS
ANELAQLFGLSDVSSECWKTVLKEVDQNNDGEIDFKEFRDMLVKLCNY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50345704
NameBDBM50345704
Synonyms:1-(tert-butyl)-3-(naphthalen-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine (3) | 1-tert-butyl-3-(naphthalen-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine | 1-tert-butyl-3-(naphthalen-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine (3) | 1-tert-butyl-3-naphthalen-2-yl-1H-pyrazolo[3,4-d]pyrimidin-4-amine | CHEMBL1231371 | CHEMBL2069957 | US9518026, Example 2 | US9765037, Compound 2
TypeSmall organic molecule
Emp. Form.C19H19N5
Mol. Mass.317.3877
SMILESCC(C)(C)n1nc(-c2ccc3ccccc3c2)c2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a