Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 3
LigandBDBM50397670
Substrate/Competitorn/a
Meas. Tech.ChEMBL_873615
IC50 630.96±n/a nM
Citation Seal, JLamotte, YDonche, FBouillot, AMirguet, OGellibert, FNicodeme, EKrysa, GKirilovsky, JBeinke, SMcCleary, SRioja, IBamborough, PChung, CWGordon, LLewis, TWalker, ALCutler, LLugo, DWilson, DMWitherington, JLee, KPrinjha, RK Identification of a novel series of BET family bromodomain inhibitors: binding mode and profile of I-BET151 (GSK1210151A). Bioorg Med Chem Lett22:2968-72 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 3
Name:Bromodomain-containing protein 3
Synonyms:Bromodomain-containing protein 3 | Bromodomain-containing protein 3 (BRD3) | RING3-like protein
Type:Protein
Mol. Mass.:79571.81
Organism:Homo sapiens (Human)
Description:Q15059
Residue:726
Sequence:
MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFY
QPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTD
DIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPA
TPFQSVPPTVSQTPVIAATPVPTITANVTSVPVPPAAAPPPPATPIVPVVPPTPPVVKKK
GVKRKADTTTPTTSAITASRSESPPPLSDPKQAKVVARRESGGRPIKPPKKDLEDGEVPQ
HAGKKGKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLST
VKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPV
EAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAAL
SQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKA
NSTTTAGRQLKKGGKQASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQ
SREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSCLQKKQRKPFSASGKKQAAKSKEEL
AQEKKKELEKRLQDVSGQLSSSKKPARKEKPGSAPSGGPSRLSSSSSSESGSSSSSGSSS
DSSDSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50397670
NameBDBM50397670
Synonyms:CHEMBL2181820
TypeSmall organic molecule
Emp. Form.C23H21N5O3
Mol. Mass.415.4445
SMILESCOc1cc2c3n([C@@H](C)c4ccccn4)c(=O)[nH]c3cnc2cc1-c1c(C)noc1C |r,wU:7.7,(68,-36.92,;68,-38.46,;69.33,-39.23,;70.67,-38.46,;72.01,-39.23,;73.35,-38.45,;73.68,-36.93,;72.66,-35.78,;71.15,-36.09,;73.15,-34.32,;72.12,-33.19,;72.6,-31.73,;74.11,-31.41,;75.13,-32.56,;74.65,-34.02,;75.23,-36.78,;76.01,-35.45,;75.86,-38.21,;74.69,-39.24,;74.69,-40.79,;73.35,-41.55,;72.01,-40.79,;70.67,-41.55,;69.33,-40.79,;68,-41.55,;67.84,-43.08,;68.98,-44.11,;66.34,-43.4,;65.56,-42.07,;66.59,-40.93,;66.27,-39.42,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a