Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 3
LigandBDBM50380676
Substrate/Competitorn/a
Meas. Tech.ChEMBL_873615
IC50 398.11±n/a nM
Citation Seal, JLamotte, YDonche, FBouillot, AMirguet, OGellibert, FNicodeme, EKrysa, GKirilovsky, JBeinke, SMcCleary, SRioja, IBamborough, PChung, CWGordon, LLewis, TWalker, ALCutler, LLugo, DWilson, DMWitherington, JLee, KPrinjha, RK Identification of a novel series of BET family bromodomain inhibitors: binding mode and profile of I-BET151 (GSK1210151A). Bioorg Med Chem Lett22:2968-72 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 3
Name:Bromodomain-containing protein 3
Synonyms:Bromodomain-containing protein 3 | Bromodomain-containing protein 3 (BRD3) | RING3-like protein
Type:Protein
Mol. Mass.:79571.81
Organism:Homo sapiens (Human)
Description:Q15059
Residue:726
Sequence:
MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFY
QPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTD
DIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPA
TPFQSVPPTVSQTPVIAATPVPTITANVTSVPVPPAAAPPPPATPIVPVVPPTPPVVKKK
GVKRKADTTTPTTSAITASRSESPPPLSDPKQAKVVARRESGGRPIKPPKKDLEDGEVPQ
HAGKKGKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLST
VKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPV
EAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAAL
SQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKA
NSTTTAGRQLKKGGKQASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQ
SREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSCLQKKQRKPFSASGKKQAAKSKEEL
AQEKKKELEKRLQDVSGQLSSSKKPARKEKPGSAPSGGPSRLSSSSSSESGSSSSSGSSS
DSSDSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50380676
NameBDBM50380676
Synonyms:CHEMBL2017283
TypeSmall organic molecule
Emp. Form.C26H26N4O3
Mol. Mass.442.5096
SMILESCOc1cc2c3n(-c4ccccc4C(C)(C)C)c(=O)[nH]c3cnc2cc1-c1c(C)noc1C |(4.94,-26.84,;4.94,-28.38,;6.27,-29.15,;7.6,-28.38,;8.94,-29.14,;10.26,-28.37,;10.57,-26.87,;9.8,-25.54,;8.27,-25.55,;7.49,-24.22,;8.26,-22.87,;9.81,-22.88,;10.57,-24.21,;12.11,-24.21,;12.1,-22.67,;13.6,-24.61,;13.44,-23.43,;12.09,-26.7,;12.85,-25.35,;12.73,-28.09,;11.6,-29.13,;11.61,-30.68,;10.27,-31.45,;8.94,-30.69,;7.61,-31.47,;6.27,-30.7,;4.94,-31.46,;4.9,-33.01,;6.13,-33.94,;3.43,-33.45,;2.55,-32.19,;3.48,-30.96,;3.03,-29.49,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a