Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 1C (PDE1C)
LigandBDBM50300099
Substrate/Competitorn/a
Meas. Tech.ChEMBL_876338
IC50 0.400000±n/a nM
Citation Verhoest, PRFonseca, KRHou, XProulx-Lafrance, CCorman, MHelal, CJClaffey, MMTuttle, JBCoffman, KJLiu, SNelson, FKleiman, RJMenniti, FSSchmidt, CJVanase-Frawley, MLiras, S Design and discovery of 6-[(3S,4S)-4-methyl-1-(pyrimidin-2-ylmethyl)pyrrolidin-3-yl]-1-(tetrahydro-2H-pyran-4-yl)-1,5-dihydro-4H-pyrazolo[3,4-d]pyrimidin-4-one (PF-04447943), a selective brain penetrant PDE9A inhibitor for the treatment of cognitive disorders. J Med Chem55:9045-54 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 1C (PDE1C)
Name:Phosphodiesterase 1C (PDE1C)
Synonyms:Phosphodiesterase 1 | Phosphodiesterase 1C | Phosphodiesterase, PDE1/PDE5
Type:Enzyme
Mol. Mass.:80778.58
Organism:Homo sapiens (Human)
Description:Q14123
Residue:709
Sequence:
MESPTKEIEEFESNSLKYLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVD
LKKNLEYAATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRR
SDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALKDVDKWSFDVFSLNEAS
GDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTV
HYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENH
HLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPE
AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR
SGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKAR
LAAEEQQKEMEAKSQAEEGASGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGE
QQQNGDFKDGKNKTDKKDHSNIGNDSKKTDGTKQRSHGSPAPSTSSTCRLTLPVIKPPLR
HFKRPAYASSSYAPSVSKKTDEHPARYKMLDQRIKMKKIQNISHNWNRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50300099
NameBDBM50300099
Synonyms:6-benzyl-1-cyclopentyl-1,5-dihydro-4H-pyrazolo[3,4-d]pyrimidin-4-one | 6-benzyl-1-cyclopentyl-1H-pyrazolo[3,4-d]pyrimidin-4(5H)-one | CHEMBL572934
TypeSmall organic molecule
Emp. Form.C17H18N4O
Mol. Mass.294.351
SMILESO=c1[nH]c(Cc2ccccc2)nc2n(ncc12)C1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a