Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetmineralocorticoid
LigandBDBM50004519
Substrate/Competitorn/a
Meas. Tech.ChEMBL_873476
IC50<500±n/a nM
Citation Piotrowski, DW Mineralocorticoid receptor antagonists for the treatment of hypertension and diabetic nephropathy. J Med Chem55:7957-66 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
mineralocorticoid
Name:mineralocorticoid
Synonyms:MR | Mineralocorticoid Receptor (MR) | Mineralocorticoid receptor | Nuclear receptor subfamily 3 group C member 2
Type:Enzyme Catalytic Domain
Mol. Mass.:106748.15
Organism:RAT
Description:mineralocorticoid 0 RAT::P22199
Residue:981
Sequence:
METKGYHSLPEGLDMERRWSQVSQTLERSSLGPAERTTENNYMEIVNVSCVSGAIPNNST
QGSSKEKHELLPYIQQDNSRSGILPSDIKTELESKELSATVAESMGLYMDSVRDAEYTYD
QQNQQGSLSPTKIYQNMEQLVKFYKENGHRSSTLSAMSRPLRSFMPDSAASMNGGALRAI
VKSPIICHEKSSSVSSPLNMASSVCSPVGINSMSSSTTSFGSFPVHSPITQGTSLTCSPS
VENRGSRSHSPTHASNVGSPLSSPLSSMKSPISSPPSHCSVKSPVSSPNNVPLRSSVSSP
ANLNNSRCSVSSPSNNTNNRSTLSSPTASTVGSIGSPISNAFSYATSGASAGAGAIQDVV
PSPDTHEKGAHDVPFPKTEEVEKAISNGVTGPLNIVQYIKSEPDGAFSSSCLGGNSKISP
SSPFSVPIKQESSKHSCSGASFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPG
FDGSCEDSAFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSP
RDQSFQHLSSFPPVNTLVESWKPHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRP
SKICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACR
LQKCLQAGMNLGARKSKKLGKLKGLHEEQPQQPPPPPPQSPEEGTTYIAPTKEPSVNSAL
VPQLTSITHALTPSPAMILENIEPETVYAGYDNSKPDTAESLLSTLNRLAAKQMIQVVKW
AKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQLLYFAPDLVFNEEKMHQS
AMYELCQGMRQISLQFVRLQLTFEEYSIMKVLLLLSTVPKDGLKSQAAFEEMRTNYIKEL
RKMVTKCPNSSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESQALKVEFPAMLVEI
ITDQLPKVESGNAKPLYFHRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004519
NameBDBM50004519
Synonyms:CHEMBL2181929
TypeSmall organic molecule
Emp. Form.C17H17FN2O4S
Mol. Mass.364.391
SMILESCC1(C)Oc2cc(NS(C)(=O)=O)ccc2N(C1=O)c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a