Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtective antigen
LigandBDBM50398483
Substrate/Competitorn/a
Meas. Tech.ChEMBL_872964
EC50 1000±n/a nM
Citation Wein, ANWilliams, BNLiu, SErmolinsky, BProvenzano, DAbagyan, ROrry, ALeppla, SHPeredelchuk, M Small molecule inhibitors of Bacillus anthracis protective antigen proteolytic activation and oligomerization. J Med Chem55:7998-8006 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protective antigen
Name:Protective antigen
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:85806.95
Organism:Bacillus anthracis
Description:ChEMBL_872965
Residue:764
Sequence:
MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA
PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV
DDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL
QLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIH
EKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIIL
SKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSST
VAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL
ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD
TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPS
DPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNA
TNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNI
DKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISN
PNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50398483
NameBDBM50398483
Synonyms:CHEMBL2179141
TypeSmall organic molecule
Emp. Form.C27H22N2O4
Mol. Mass.438.4746
SMILESOc1ccccc1\C=N\c1ccc(Cc2ccc(\N=C\c3ccccc3O)c(O)c2)cc1O
Structure
n/a