Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase I isoform alpha
LigandBDBM50400750
Substrate/Competitorn/a
Meas. Tech.ChEMBL_880534
IC50 568±n/a nM
Citation Huang, HAcquaviva, LBerry, VBregman, HChakka, NDiMauro, EFDovey, JEpstein, OGrubinska, BGoldstein, JGunaydin, HHua, ZHuang, XHuang, LHuman, JLong, ANewcomb, JPatel, VFSaffran, DSerafino, RSchneider, SStrathdee, CTang, JTurci, SWhite, RYu, VZhao, HWilson, CMartin, MW Structure-Based Design of Potent and Selective CK1 Inhibitors. ACS Med Chem Lett3:1059-1064 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein kinase I isoform alpha
Name:Casein kinase I isoform alpha
Synonyms:CK1 | CKI-alpha | CSNK1A1 | Casein Kinase I | Casein kinase 1 alpha (CK1 alpha)
Type:Serine/threonine-protein kinase
Mol. Mass.:38936.59
Organism:Homo sapiens (Human)
Description:P48729
Residue:337
Sequence:
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50400750
NameBDBM50400750
Synonyms:CHEMBL2203554
TypeSmall organic molecule
Emp. Form.C20H19FN4O2
Mol. Mass.366.3889
SMILESCOc1cnc(CCc2ccc(F)cc2)nc1-c1cc2c(CCNC2=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a