BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThromboxane A2 receptor
LigandBDBM50391307
Substrate/Competitorn/a
Meas. Tech.ChEMBL_209756
Kd 15.85±n/a nM
Citation Campbell, ICollington, EFinch, HHayes, RLumley, PMills, KRobertson, GWharton, KWatts, I Synthesis and pharmacological evaluation of combined Thromboxane receptor antagonists/thromboxane synthase inhibitors: Pyridine-containing amino-prostanoids Bioorg Med Chem Lett1:695-698 (1991)    Article
More Info.:Get all data from this article,  Assay Method
 
Thromboxane A2 receptor
Name:Thromboxane A2 receptor
Synonyms:TXA2/PGH2 | Thromboxane A2
Type:Enzyme Catalytic Domain
Mol. Mass.:36943.05
Organism:RAT
Description:Thromboxane A2 TBXA2R RAT::P34978
Residue:341
Sequence:
MWLNSTSLGACFRPVNITLQERRAIASPWFAASFCALGLGSNLLALSVLAGARPGAGPRS
SFLALLCGLVLTDFLGLLVTGAVVASQHAALLDWRATDPGCRLCHFMGAAMVFFGLCPLL
LGAAMAAERFVGITRPFSRPAATSRRAWATVGLVWVGAGTLGLLPLLGLGRYSVQYPGSW
CFLTLGAERGDVAFGLMFALLGSVSVGLSLLLNTVSVATLCRVYHAREATQRPRDCEVEM
MVQLVGIMVVATVCWMPLLVFILQTLLQTLPVMSPSGQLLRTTERQLLIYLRVATWNQIL
DPWVYILFRRSVLRRLHPRFTSQLQAVSLHSPPTQAMLSGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50391307
NameBDBM50391307
Synonyms:CHEMBL162133
TypeSmall organic molecule
Emp. Form.C30H40N2O5
Mol. Mass.508.649
SMILESOCc1cnccc1-c1ccc(CO[C@@H]2CC[C@@H]([C@H]2OC\C=C/CCC(O)=O)N2CCCCCC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a