BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50403358
Substrate/Competitorn/a
Meas. Tech.ChEBML_157883
Ki 2.8±n/a nM
Citation Thompson, SKEppley, AMFrazee, JSDarcy, MGLum, RTTomaszek, TAIvanoff, LAMorris, JFSternberg, EJLambert, DMFernandez, AVPetteway, SRMeek, TDMetcalf, BWGleason, JG Synthesis and antiviral activity of a novel class of HIV-1 protease inhibitors containing a heterocyclic P1-P2 amide bond isostere Bioorg Med Chem Lett4:2441-2446 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50403358
NameBDBM50403358
Synonyms:CHEMBL78531
TypeSmall organic molecule
Emp. Form.C32H44N4O4
Mol. Mass.548.7162
SMILESCCOC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](Cc1ccccc1)[C@@H](O)C[C@@H](Cc1ccccc1)c1ncc([nH]1)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a