Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 2C
LigandBDBM31005
Substrate/Competitorn/a
Meas. Tech.ChEBML_2739
IC50 7.4±n/a nM
Citation Andrés, JIAlcázar, JAlonso, JMDíaz, AFernández, JGil, PIturrino, LMatesanz, EMeert, TFMegens, ASipido, VK Synthesis and structure-activity relationship of 2-(aminoalkyl)-2,3,3a,8-tetrahydrodibenzo[c,f]isoxazolo[2,3-a]azepine derivatives: a novel series of 5-HT(2A/2C) receptor antagonists. Part 1. Bioorg Med Chem Lett12:243-8 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 2C
Name:Serotonin receptor (2b and 2c)
Synonyms:5-HT-2C | 5-HT2C | 5-HT2C-INI | 5-HT2c VGI | 5-HTR2C | 5-hydroxytryptamine receptor 1C | 5-hydroxytryptamine receptor 2A (5-HT2A) | 5-hydroxytryptamine receptor 2C (5-HT-2C) | 5-hydroxytryptamine receptor 2C (5HT-2C) | 5HT-1C | HTR1C | HTR2C | Serotonin (5-HT3) receptor | Serotonin 2c (5-HT2c) receptor | Serotonin Receptor 2C
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:51836.79
Organism:Homo sapiens (Human)
Description:P28335
Residue:458
Sequence:
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31005
NameBDBM31005
Synonyms:2-methyl-1,2,3,4,10,14b-hexahydrodibenzo[c,f]pyrazino[1,2-a]azepine | MIANSERIN HYDROCHLORIDE | MLS000069681 | SMR000058472 | cid_68551
TypeSmall organic molecule
Emp. Form.C18H21ClN2
Mol. Mass.300.826
SMILESCl.CN1CCN2C(C1)c1ccccc1Cc1ccccc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a