Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-Hydroxytryptamine receptor 7 (5-HT7)
LigandBDBM50403962
Substrate/Competitorn/a
Meas. Tech.ChEBML_3704
IC50 19±n/a nM
Citation Andrés, JIAlcázar, JAlonso, JMDíaz, AFernández, JGil, PIturrino, LMatesanz, EMeert, TFMegens, ASipido, VK Synthesis and structure-activity relationship of 2-(aminoalkyl)-2,3,3a,8-tetrahydrodibenzo[c,f]isoxazolo[2,3-a]azepine derivatives: a novel series of 5-HT(2A/2C) receptor antagonists. Part 1. Bioorg Med Chem Lett12:243-8 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-Hydroxytryptamine receptor 7 (5-HT7)
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-7 | 5-HT-X | 5-HT7 | 5-HT7L | 5-HT7S | 5-HT7b | 5-hydroxytryptamine receptor 7 | 5HT7 | HTR7
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:53573.08
Organism:Homo sapiens (Human)
Description:P34969
Residue:479
Sequence:
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
IPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50403962
NameBDBM50403962
Synonyms:CHEMBL81485
TypeSmall organic molecule
Emp. Form.C18H20N2O
Mol. Mass.280.3642
SMILESCNCC1CC2N(O1)c1ccccc1Cc1ccccc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a