Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInosine-5'-monophosphate dehydrogenase
LigandBDBM50366998
Substrate/Competitorn/a
Meas. Tech.ChEMBL_89668
Ki 41000±n/a nM
Citation Skibo, EBMeyer, RB Inhibition of inosinic acid dehydrogenase by 8-substituted purine nucleotides. J Med Chem24:1155-61 (1982) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Inosine-5'-monophosphate dehydrogenase
Name:Inosine-5'-monophosphate dehydrogenase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:52020.85
Organism:Escherichia coli (strain K12)
Description:ChEMBL_89670
Residue:488
Sequence:
MLRIAKEALTFDDVLLVPAHSTVLPNTADLSTQLTKTIRLNIPMLSAAMDTVTEARLAIA
LAQEGGIGFIHKNMSIERQAEEVRRVKKHESGVVTDPQTVLPTTTLREVKELTERNGFAG
YPVVTEENELVGIITGRDVRFVTDLNQPVSVYMTPKERLVTVREGEAREVVLAKMHEKRV
EKALVVDDEFHLIGMITVKDFQKAERKPNACKDEQGRLRVGAAVGAGAGNEERVDALVAA
GVDVLLIDSSHGHSEGVLQRIRETRAKYPDLQIIGGNVATAAGARALAEAGCSAVKVGIG
PGSICTTRIVTGVGVPQITAVADAVEALEGTGIPVIADGGIRFSGDIAKAIAAGASAVMV
GSMLAGTEESPGEIELYQGRSYKSYRGMGSLGAMSKGSSDRYFQSDNAADKLVPEGIEGR
VAYKGRLKEIIHQQMGGLRSCMGLTGCGTIDELRTKAEFVRISGAGIQESHVHDVTITKE
SPNYRLGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50366998
NameBDBM50366998
Synonyms:CHEMBL603972
TypeSmall organic molecule
Emp. Form.C18H21N4O9PS
Mol. Mass.500.42
SMILESCOc1ccc(CSc2nc3c(nc[nH]c3=O)n2C2O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]2O)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a