Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-1 adrenergic receptor
LigandBDBM50404791
Substrate/Competitorn/a
Meas. Tech.ChEMBL_76827
Kd 0.000001±n/a nM
Citation Erhardt, PWWoo, CMAnderson, WGGorczynski, RJ Ultra-short-acting beta-adrenergic receptor blocking agents. 2. (Aryloxy)propanolamines containing esters on the aryl function. J Med Chem25:1408-12 (1983) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-1 adrenergic receptor
Name:Beta-1 adrenergic receptor
Synonyms:ADRB1 | Adrenergic receptor | adrenergic Beta1
Type:Enzyme Catalytic Domain
Mol. Mass.:50540.48
Organism:GUINEA PIG
Description:adrenergic Beta1 ADRB1 GUINEA PIG::B0FL73
Residue:467
Sequence:
MGAGVLALGASEPCNLSSTAPLPDGAATAARLLVPASPPASLLPPTSEGSEPLSPQWTAG
MGLLMVLIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARVLVC
TVWAISALVSFLPILMHWWRAEGDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPGRPPSPVPSPTPGSPRAATDPLANGRTSKRR
PSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANS
AFNPIIYCRSPDFRKAFQRLLCCARRAARRRHTAHGGRPRASGCLARSGPPPSPGAASDE
DEDAVGAAPPARLLEPWAGCNGGAATADSDWSLDEPGRAGFASESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50404791
NameBDBM50404791
Synonyms:CHEMBL31025
TypeSmall organic molecule
Emp. Form.C17H27NO4
Mol. Mass.309.4006
SMILESCOC(=O)CCc1ccc(OCC(O)CNC(C)(C)C)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a