Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlkaline phosphatase tissue-nonspecific
LigandBDBM14363
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29968
IC50 1750000±n/a nM
Citation Schwender, CFSunday, BRDecker, VL Alkaline phosphatase inhibition by a series of pyrido[2,1-b]quinazolines: A possible relationship with cromolyn-like antiallergy activity. J Med Chem25:742-5 (1982) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alkaline phosphatase tissue-nonspecific
Name:Alkaline phosphatase tissue-nonspecific
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:57663.75
Organism:Rattus norvegicus
Description:ChEMBL_29968
Residue:524
Sequence:
MILPFLVLAIGTCLTNSFVPEKEKDPSYWRQQAQETLKNALKLQKLNTNVAKNIIMFLGD
GMGVSTVTAARILKGQLHHNTGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATERTRCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAH
SADRDWYSDNEMPPEALSQGCKDIAYQLMHNIKDIDVIMGGGRKYMYPKNRTDVEYELDE
KARGTRLDGLDLISIWKSFKPRHKHSHYVWNRTELLALDPSRVDYLLGLFEPGDMQYELN
RNNLTDPSLSEMVEVALRILTKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDEAIG
KAGTMTSQKDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMVSDTDKKPFTAILYGNGPG
YKVVDGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFAKGPMAHLLHGVHEQNYI
PHVMAYASCIGANLDHCAWASSASSPSPGALLLPLALFPLRTLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14363
NameBDBM14363
Synonyms:3-(2-propoxyphenyl)-2,4,7,8,9-pentazabicyclo[4.3.0]nona-1,3,6-trien-5-one | 5-(2-propoxyphenyl)-2H,3H,7H-[1,2,3]triazolo[4,5-d]pyrimidin-7-one | Tocris-0947 | ZAPRINAST | Zaprinast
TypeSmall organic molecule
Emp. Form.C13H13N5O2
Mol. Mass.271.2746
SMILESCCCOc1ccccc1-c1nc2nn[nH]c2c(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a