Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA topoisomerase III
LigandBDBM50028327
Substrate/Competitorn/a
Meas. Tech.ChEBML_54524
Ki 849±n/a nM
Citation Wright, GEGambino, JJ Quantitative structure-activity relationships of 6-anilinouracils as inhibitors of Bacillus subtilis DNA polymerase III. J Med Chem27:181-5 (1984) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNA topoisomerase III
Name:DNA topoisomerase III
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:81515.22
Organism:Bacillus subtilis
Description:ChEMBL_54525
Residue:727
Sequence:
MSKTVVLAEKPSVGRDLARVLKCHKKGNGYLEGDQYIVTWALGHLVTLADPEGYGKEFQS
WRLEDLPIIPEPLKLVVIKKTGKQFNAVKSQLTRKDVNQIVIATDAGREGELVARWIIEK
ANVRKPIKRLWISSVTDKAIKEGFQKLRSGKEYENLYHSAVARAEADWIVGINATRALTT
KFNAQLSCGRVQTPTLAMIAKREADIQAFTPVPYYGIRAAVDGMTLTWQDKKSKQTRTFN
QDVTSRLLKNLQGKQAVVAELKKTAKKSFAPALYDLTELQRDAHKRFGFSAKETLSVLQK
LYEQHKLVTYPRTDSRFLSSDIVPTLKDRLEGMEVKPYAQYVSQIKKRGIKSHKGYVNDA
KVSDHHAIIPTEEPLVLSSLSDKERKLYDLIAKRFLAVLMPAFEYEETKVIAEIGGETFT
AKGKTVQSQGWKAVYDMAEEDDEQEDDRDQTLPALQKGDTLAVRTLTETSGQTKPPARFN
EGTLLSAMENPSAFMQGEEKGLVKTLGETGGLGTVATRADIIEKLFNSFLIEKKGQDIFI
TSKGKQLLQLVPEDLKSPALTAEWEQKLSAIAAGKLKSAVFIKDMKAYAHQTVKEIKNSS
QTFRHDNITGTACPECGKMMLKVNGKRGTMLVCQDRECGSRKTIARKTNARCPNCHKRME
LRGQGEGQTFACVCGHREKLSVFEKRKNKDKARATKRDVSSYMKKQNKDEPINNALAEQL
KKLGLDK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50028327
NameBDBM50028327
Synonyms:6-(4-Bromo-3-methyl-phenylamino)-1H-pyrimidine-2,4-dione | CHEMBL53413
TypeSmall organic molecule
Emp. Form.C11H10BrN3O2
Mol. Mass.296.12
SMILESCc1cc(Nc2cc(=O)[nH]c(=O)[nH]2)ccc1Br
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a