Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholine Acetyltransferase
LigandBDBM50405555
Substrate/Competitorn/a
Meas. Tech.ChEMBL_49116
IC50 10000±n/a nM
Citation DeBernardis, JFGifford, PRizk, MErtel, RAbraham, DJSiuda, JF Evaluation of the side arm of (naphthylvinyl)pyridinium inhibitors of choline acetyltransferase. J Med Chem31:117-21 (1988) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Choline Acetyltransferase
Name:Choline acetylase
Synonyms:Choline O-acetyltransferase
Type:Enzyme Catalytic Domain
Mol. Mass.:71875.58
Organism:RAT
Description:Choline Acetyltransferase 0 RAT::P32738
Residue:640
Sequence:
MPILEKAPQKMPVKASSWEELDLPKLPVPPLQQTLATYLQCMQHLVPEEQFRKSQAIVKR
FGAPGGLGETLQEKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFQDT
NDQLRFAACLISGVLSYKTLLDSHSLPTDWAKGQLSGQPLCMKQYYRLFSSYRLPGHTQD
TLVAQKSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLP
PIGLLTSDGRSEWAKARTVLLKDSTNRDSLDMIERCICLVCLDGPGTGELSDTHRALQLL
HGGGCSLNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMMTSNKKL
VRADSVSELPAPRRLRLKCSPETQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQK
YSPDGFIQVALQLAYYRLYQRLVPTYESASIRRFQEGRVDNIRSATPEALAFVQAMTDHK
AAMPASEKLQLLQTAMQAHKQYTVMAITGMAIDNHLLALRELARDLCKEPPEMFMDETYL
MSNRFVLSTSQVPTTMEMFCCYGPVVPNGNGACYNPQPEAITFCISSFHSCKETSSVEFA
EAVGASLVDMRDLCSSRQPADSKPPAPKEKARGPSQAKQS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50405555
NameBDBM50405555
Synonyms:CHEMBL282917
TypeSmall organic molecule
Emp. Form.C20H17BrNO
Mol. Mass.367.259
SMILESBrCC(=O)C[n+]1ccc(\C=C\c2cccc3ccccc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a