Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50406212
Substrate/Competitorn/a
Meas. Tech.ChEMBL_21101
Ki 1.259E3±n/a nM
KOFF 1.995E-5 s-1
KON 1.585E1 M-1s-1
Citation Krantz, ASpencer, RWTam, TFLiak, TJCopp, LJThomas, EMRafferty, SP Design and synthesis of 4H-3,1-benzoxazin-4-ones as potent alternate substrate inhibitors of human leukocyte elastase. J Med Chem33:464-79 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50406212
NameBDBM50406212
Synonyms:CHEMBL357238
TypeSmall organic molecule
Emp. Form.C17H22N2O4
Mol. Mass.318.3676
SMILESCOC(=O)[C@H](CC(C)C)Nc1nc2cc(C)cc(C)c2c(=O)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a