Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50058420
Substrate/Competitorn/a
Meas. Tech.ChEMBL_54934
IC50 9000000000±n/a nM
Citation Denny, BJRingan, NSSchwalbe, CHLambert, PAMeek, MAGriffin, RJStevens, MF Structural studies on bio-active compounds. 20. Molecular modeling and crystallographic studies on methylbenzoprim, a potent inhibitor of dihydrofolate reductase. J Med Chem35:2315-20 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase; P. carinii vs rat
Synonyms:Dihydrofolate reductase (DHFR) | Tetrahydrofolate dehydrogenase
Type:Enzyme
Mol. Mass.:21638.84
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:187
Sequence:
MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50058420
NameBDBM50058420
Synonyms:(methylbenzoprim, MBP) 5-[4-(Benzyl-methyl-amino)-3-nitro-phenyl]-6-ethyl-pyrimidine-2,4-diamine | 5-[4-(Benzyl-methyl-amino)-3-nitro-phenyl]-6-ethyl-pyrimidine-2,4-diamine | CHEMBL56170 | cid_72438
TypeSmall organic molecule
Emp. Form.C20H22N6O2
Mol. Mass.378.4277
SMILESCCc1nc(N)nc(N)c1-c1ccc(N(C)Cc2ccccc2)c(c1)[N+]([O-])=O
Structure
n/a