Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin receptor 2a and 2c (5HT2A and 5HT2C)
LigandBDBM50407854
Substrate/Competitorn/a
Meas. Tech.ChEMBL_2783
Ki 0.955±n/a nM
Citation Audia, JEEvrard, DAMurdoch, GRDroste, JJNissen, JSSchenck, KWFludzinski, PLucaites, VLNelson, DLCohen, ML Potent, selective tetrahydro-beta-carboline antagonists of the serotonin 2B (5HT2B) contractile receptor in the rat stomach fundus. J Med Chem39:2773-80 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin receptor 2a and 2c (5HT2A and 5HT2C)
Name:Serotonin (5-HT) receptor
Synonyms:5-HT2C | 5-hydroxytryptamine receptor 2C | 5-hydroxytryptamine receptor 2C (5HT2c) | HTR2C
Type:Enzyme
Mol. Mass.:51935.10
Organism:Rattus norvegicus (Rat)
Description:P08909
Residue:460
Sequence:
MVNLGNAVRSLLMHLIGLLVWQFDISISPVAAIVTDTFNSSDGGRLFQFPDGVQNWPALS
IVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYV
WPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVW
AISIGVSVPIPVIGLRDESKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTIY
VLRRQTLMLLRGHTEEELANMSLNFLNCCCKKNGGEEENAPNPNPDQKPRRKKKEKRPRG
TMQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGY
VCSGINPLVYTLFNKIYRRAFSKYLRCDYKPDKKPPVRQIPRVAATALSGRELNVNIYRH
TNERVARKANDPEPGIEMQVENLELPVNPSNVVSERISSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50407854
NameBDBM50407854
Synonyms:CHEMBL96485
TypeSmall organic molecule
Emp. Form.C23H23FN2
Mol. Mass.346.4405
SMILESCc1ccc2NC3C(CCNC3Cc3cccc4ccccc34)c2c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a