Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinesterases
LigandBDBM50039723
Substrate/Competitorn/a
Meas. Tech.ChEMBL_28756
IC50 8.79±n/a nM
Citation Tong, WCollantes, ERChen, YWelsh, WJ A comparative molecular field analysis study of N-benzylpiperidines as acetylcholinesterase inhibitors. J Med Chem39:380-7 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cholinesterases
Name:Cholinesterases; ACHE & BCHE
Synonyms:AChE | Acetylcholinesterase (AChE) | Acetylcholinesterase (human AChE)
Type:Enzyme
Mol. Mass.:67792.70
Organism:Homo sapiens (Human)
Description:P22303
Residue:614
Sequence:
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPV
SAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM
NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV
GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG
VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY
EIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ
YVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50039723
NameBDBM50039723
Synonyms:3-(2-(1-benzylpiperidin-4-yl)ethyl)benzo[d]isoxazole-6-carboxamide | 3-[2-(1-Benzyl-piperidin-4-yl)-ethyl]-benzo[d]isoxazole-6-carboxylic acid amide | CHEMBL92663
TypeSmall organic molecule
Emp. Form.C22H25N3O2
Mol. Mass.363.4528
SMILESNC(=O)c1ccc2c(CCC3CCN(Cc4ccccc4)CC3)noc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a