Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCG8425-PA [Drosophila melanogaster]
LigandBDBM50371960
Substrate/Competitorn/a
Meas. Tech.ChEMBL_92659
IC50 147.91±n/a nM
Citation Wheelock, CEColvin, MEUemura, IOlmstead, MMSanborn, JRNakagawa, YJones, ADHammock, BD Use of ab initio calculations to predict the biological potency of carboxylesterase inhibitors. J Med Chem45:5576-93 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
CG8425-PA [Drosophila melanogaster]
Name:CG8425-PA [Drosophila melanogaster]
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:64506.23
Organism:Drosophila melanogaster
Description:ChEMBL_92659
Residue:579
Sequence:
MIQQRMLQLLLLGQLLAGPGPFCAALATVDQLTVCPPSVGCLKGTNLQGYQSERFEAFMG
IPYALPPIGDLRFSNPKVMPKLLGMYDASAPKMDCIQKNYLLPTPVVYGDEDCLYLNVYR
PEIRKSALPVMVYIHGGGFFGGSAGPGVTGPEYFMDSGEVILVTMAYRLGPFGFLSTQDA
VMSGNFGLKDQNLALRWVQRNIRFFGGDPQRVTIFGQSAGGVAAHMHLLSPRSHGLFHRV
ISMSGTANVPFAIAEQPLEQARLLAEFADVPDARNLSTVKLTKALRRINATKLLNAGDGL
KYWDVDHMTNFRPVVEEGLEVDAFLNAHPMDMLAQGMPTSIPLLLGTVPGEGAVRVVNIL
GNETLRQSFNLRFDELLQELLEFPASFSQDRREKMMDLLVEVYFQGQHEVNELTVQGFMN
LISDRGFKQPLYNTIHKNVCHTPNPVYLYSFNYQGPLSYASAYTSANVTGKYGVVHCDDL
LYLFRSPLLFPDFQRNSTEAKVIHSFVDYFVHFAKFGKPRNSESLTPCSIEVLQSRPDGI
CDYHEFANAPDAYQGFEVHVASEFQTDRVNLWSHILNEK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50371960
n/a
NameBDBM50371960
Synonyms:CHEMBL155621
TypeSmall organic molecule
Emp. Form.C9H15F3O3S
Mol. Mass.260.274
SMILESCCCCCCS(=O)(=O)CC(=O)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: