Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT2
LigandBDBM50219142
Substrate/Competitorn/a
Meas. Tech.ChEMBL_491081
Kd 3.39±n/a nM
Citation Enzensperger, CGörnemann, TPertz, HHLehmann, J Dopamine/serotonin receptor ligands. Part 17: a cross-target SAR approach: affinities of azecine-styled ligands for 5-HT(2A) versus D1 and D2 receptors. Bioorg Med Chem Lett18:3809-13 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-HT2
Name:Serotonin 2a (5-HT2a) receptor
Synonyms:5-HT-2 | 5-HT-2A | 5-HT2A
Type:Enzyme Catalytic Domain
Mol. Mass.:52679.13
Organism:PIG
Description:5-HT2 0 0::P50129
Residue:470
Sequence:
MDVLCEENTSLSSPTNSFMQLNDDTRLYHNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPPCFSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHRRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGAL
LNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKS
SQLQTGQKENSKQDDKATENDCTMVALGKQHSEDAPADNSNTVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50219142
NameBDBM50219142
Synonyms:3-methoxy-7-methyl-6,7,8,9,10,15-hexahydro-5H-dibenzo[d,g]azacycloundecene | 3-methoxy-7-methyl-6,7,8,9,10,15-hexahydro-5H-dibenzo[d,g]azacycloundecine | CHEMBL276778
TypeSmall organic molecule
Emp. Form.C20H25NO
Mol. Mass.295.4186
SMILESCOc1ccc2Cc3ccccc3CCCN(C)CCc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a