Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase A-interacting protein
LigandBDBM50350908
Substrate/Competitorn/a
Meas. Tech.ChEMBL_502288
IC50 7943±n/a nM
Citation Liddle, JBamborough, PBarker, MDCampos, SCousins, RPCutler, GJHobbs, HHolmes, DSIoannou, CMellor, GWMorse, MAPayne, JJPritchard, JMSmith, KJTape, DTWhitworth, CWilliamson, RA 4-Phenyl-7-azaindoles as potent and selective IKK2 inhibitors. Bioorg Med Chem Lett19:2504-8 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aurora kinase A-interacting protein
Name:Aurora kinase A-interacting protein
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:22379.19
Organism:Homo sapiens (Human)
Description:ChEMBL_502288
Residue:199
Sequence:
MLLGRLTSQLLRAVPWAGGRPPWPVSGVLGSRVCGPLYSTSPAGPGRAASLPRKGAQLEL
EEMLVPRKMSVSPLESWLTARCFLPRLDTGTAGTVAPPQSYQCPPSQIGEGAEQGDEGVA
DAPQIQCKNVLKIRRRKMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKA
GLKEAPEGWQTPKIYLRGK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50350908
NameBDBM50350908
Synonyms:CHEMBL520308
TypeSmall organic molecule
Emp. Form.C17H19N3O3S
Mol. Mass.345.416
SMILESCN(CCO)S(=O)(=O)c1ccc(cc1)-c1ccnc2[nH]c(C)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a