Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEcdysone receptor
LigandBDBM50226672
Substrate/Competitorn/a
Meas. Tech.ChEMBL_582869
IC50 112.2±n/a nM
Citation Harada, TNakagawa, YAkamatsu, MMiyagawa, H Evaluation of hydrogen bonds of ecdysteroids in the ligand-receptor interactions using a protein modeling system. Bioorg Med Chem17:5868-73 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ecdysone receptor
Name:Ecdysone receptor
Synonyms:20-hydroxy-ecdysone receptor | 20E receptor | EcR | EcRH | Ecdysteroid receptor | NR1H1 | Nuclear receptor subfamily 1 group H member 1
Type:PROTEIN
Mol. Mass.:93857.12
Organism:Drosophila melanogaster
Description:ChEMBL_582869
Residue:878
Sequence:
MKRRWSNNGGFMRLPEESSSEVTSSSNGLVLPSGVNMSPSSLDSHDYCDQDLWLCGNESG
SFGGSNGHGLSQQQQSVITLAMHGCSSTLPAQTTIIPINGNANGNGGSTNGQYVPGATNL
GALANGMLNGGFNGMQQQIQNGHGLINSTTPSTPTTPLHLQQNLGGAGGGGIGGMGILHH
ANGTPNGLIGVVGGGGGVGLGVGGGGVGGLGMQHTPRSDSVNSISSGRDDLSPSSSLNGY
SANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCC
KFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREKKAQKEKDKMTTSP
SSQHGGNGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILAKCQARNIPSLTYNQ
LAVIYKLIWYQDGYEQPSEEDLRRIMSQPDENESQTDVSFRHITEITILTVQLIVEFAKG
LPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRSYTRDSYKMAGMADN
IEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAIQSYYIDTLRIYILNR
HCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDVHAIPPSVQ
SHLQITQEENERLERAERMRASVGGAITAGIDCDSASTSAAAAAAQHQPQPQPQPQPSSL
TQNDSQHQTQPQLQPQLPPQLQGQLQPQLQPQLQTQLQPQIQPQPQLLPVSAPVPASVTA
PGSLSAVSTSSEYMGGSAAIGPITPATTSSITAAVTASSTTSAVPMGNGVGVGVGVGGNV
SMYANAQTAMALMGVALHSHQEQLIGGVAVKSEHSTTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50226672
NameBDBM50226672
Synonyms:CHEMBL255034 | makisterone A
TypeSmall organic molecule
Emp. Form.C28H46O7
Mol. Mass.494.6606
SMILESC[C@H](C[C@@H](O)[C@](C)(O)[C@H]1CC[C@@]2(O)C3=CC(=O)[C@@H]4C[C@@H](O)[C@@H](O)C[C@]4(C)[C@H]3CC[C@]12C)C(C)(C)O |t:13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a