Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine receptor
LigandBDBM50331549
Substrate/Competitorn/a
Meas. Tech.ChEMBL_598577
Ki 0.794±n/a nM
Citation Bennacef, ISalinas, CABonasera, TAGunn, RNAudrain, HJakobsen, SNabulsi, NWeinzimmer, DCarson, REHuang, YHolmes, IMicheli, FHeidbreder, CGentile, GRossi, TLaruelle, M Dopamine D3 receptor antagonists: the quest for a potentially selective PET ligand. Part 3: Radiosynthesis and in vivo studies. Bioorg Med Chem Lett19:5056-9 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dopamine receptor
Name:Dopamine receptor D2 and D3
Synonyms:D(3) dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor
Type:Protein
Mol. Mass.:49540.58
Organism:Rattus norvegicus (Rat)
Description:P19020
Residue:446
Sequence:
MAPLSQISTHLNSTCGAENSTGVNRARPHAYYALSYCALILAIIFGNGLVCAAVLRERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPSI
CSISNPDFVIYSSVVSFYVPFGVTVLVYARIYIVLRQRQRKRILTRQNSQCISIRPGFPQ
QSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKQYPQKCQDPLLSHLQPPSPGQTHGGLK
RYYSICQDTALRHPSLEGGAGMSPVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLRLGP
LQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYV
NSALNPVIYTTFNVEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50331549
NameBDBM50331549
Synonyms:CHEMBL567286 | [11C]-3-(2-oxo-3-(2-(4-(trifluoromethyl)piperidin-1-yl)ethyl)imidazolidin-1-yl)benzonitrile
TypeSmall organic molecule
Emp. Form.C18H21F3N4O
Mol. Mass.366.3807
SMILESFC(F)(F)C1CCN(CCN2CCN(C2=O)c2cccc(c2)C#N)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a