Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2B adrenergic receptor
LigandBDBM50419875
Substrate/Competitorn/a
Meas. Tech.ChEMBL_805962
EC50 240±n/a nM
Citation Diamanti, EDel Bello, FCarbonara, GCarrieri, AFracchiolla, GGiannella, MMammoli, VPiergentili, APohjanoksa, KQuaglia, WScheinin, MPigini, M Might the observeda(2A)-adrenoreceptor agonism or antagonism of allyphenyline analogues be ascribed to different molecular conformations? Bioorg Med Chem20:2082-90 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-2B adrenergic receptor
Name:Alpha-2B adrenergic receptor
Synonyms:ADRA2B | ADRA2L1 | ADRA2L1 | ADRA2RL1 | Adrenergic alpha2B | Adrenergic receptor alpha | Adrenergic, alpha-2B-, receptor [Homo sapiens] | Alpha-2 adrenergic receptor subtype C2 | Alpha-2B adrenoceptor | Alpha-2B adrenoreceptor | Alpha-2BAR
Type:Enzyme
Mol. Mass.:49579.89
Organism:Homo sapiens (Human)
Description:P18089
Residue:450
Sequence:
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV
ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR
AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS
LNPVIYTIFNQDFRRAFRRILCRPWTQTAW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50419875
NameBDBM50419875
Synonyms:CHEMBL1956193
TypeSmall organic molecule
Emp. Form.C12H13F3N2O
Mol. Mass.258.2396
SMILESCC(Oc1ccccc1C(F)(F)F)C1=NCCN1 |t:14|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a