Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenaline alpha1
LigandBDBM39344
Substrate/Competitorn/a
Meas. Tech.ChEMBL_838514
Ki 47000±n/a nM
Citation Urakami, YOkuda, MMasuda, SAkazawa, MSaito, HInui, K Distinct characteristics of organic cation transporters, OCT1 and OCT2, in the basolateral membrane of renal tubules. Pharm Res18:1528-34 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adrenaline alpha1
Name:Adrenaline alpha1
Synonyms:Oct1 | Organic cation transporter 1 | Slc22a1 | Solute carrier family 22 member 1 | adrenergic Alpha1 | rOCT1
Type:Enzyme Catalytic Domain
Mol. Mass.:61538.40
Organism:RAT
Description:Adrenaline alpha1 0 RAT::Q63089
Residue:556
Sequence:
MPTVDDVLEQVGEFGWFQKQAFLLLCLISASLAPIYVGIVFLGFTPGHYCQNPGVAELSQ
RCGWSQAEELNYTVPGLGPSDEASFLSQCMRYEVDWNQSTLDCVDPLSSLVANRSQLPLG
PCEHGWVYDTPGSSIVTEFNLVCGDAWKVDLFQSCVNLGFFLGSLVVGYIADRFGRKLCL
LVTTLVTSVSGVLTAVAPDYTSMLLFRLLQGMVSKGSWVSGYTLITEFVGSGYRRTTAIL
YQMAFTVGLVGLAGVAYAIPDWRWLQLAVSLPTFLFLLYYWFVPESPRWLLSQKRTTRAV
RIMEQIAQKNGKVPPADLKMLCLEEDASEKRSPSFADLFRTPNLRKHTVILMYLWFSCAV
LYQGLIMHVGATGANLYLDFFYSSLVEFPAAFIILVTIDRIGRIYPIAASNLVTGAACLL
MIFIPHELHWLNVTLACLGRMGATIVLQMVCLVNAELYPTFIRNLGMMVCSALCDLGGIF
TPFMVFRLMEVWQALPLILFGVLGLTAGAMTLLLPETKGVALPETIEEAENLGRRKSKAK
ENTIYLQVQTGKSSST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM39344
NameBDBM39344
Synonyms:4-amino-N-[2-(diethylamino)ethyl]benzamide;hydrochloride | 4-azanyl-N-[2-(diethylamino)ethyl]benzamide;hydrochloride | MLS000069436 | PROCAINAMIDE | PROCAINAMIDE HYDROCHLORIDE | SMR000059079 | cid_66068
TypeSmall organic molecule
Emp. Form.C13H21N3O
Mol. Mass.235.3253
SMILESCCN(CC)CCNC(=O)c1ccc(N)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a