Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenaline alpha1
LigandBDBM50170653
Substrate/Competitorn/a
Meas. Tech.ChEMBL_838515
Ki 72000±n/a nM
Citation Martel, FVetter, TRuss, HGründemann, DAzevedo, IKoepsell, HSchömig, E Transport of small organic cations in the rat liver. The role of the organic cation transporter OCT1. Naunyn Schmiedebergs Arch Pharmacol354:320-6 (1997) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adrenaline alpha1
Name:Adrenaline alpha1
Synonyms:Oct1 | Organic cation transporter 1 | Slc22a1 | Solute carrier family 22 member 1 | adrenergic Alpha1 | rOCT1
Type:Enzyme Catalytic Domain
Mol. Mass.:61538.40
Organism:RAT
Description:Adrenaline alpha1 0 RAT::Q63089
Residue:556
Sequence:
MPTVDDVLEQVGEFGWFQKQAFLLLCLISASLAPIYVGIVFLGFTPGHYCQNPGVAELSQ
RCGWSQAEELNYTVPGLGPSDEASFLSQCMRYEVDWNQSTLDCVDPLSSLVANRSQLPLG
PCEHGWVYDTPGSSIVTEFNLVCGDAWKVDLFQSCVNLGFFLGSLVVGYIADRFGRKLCL
LVTTLVTSVSGVLTAVAPDYTSMLLFRLLQGMVSKGSWVSGYTLITEFVGSGYRRTTAIL
YQMAFTVGLVGLAGVAYAIPDWRWLQLAVSLPTFLFLLYYWFVPESPRWLLSQKRTTRAV
RIMEQIAQKNGKVPPADLKMLCLEEDASEKRSPSFADLFRTPNLRKHTVILMYLWFSCAV
LYQGLIMHVGATGANLYLDFFYSSLVEFPAAFIILVTIDRIGRIYPIAASNLVTGAACLL
MIFIPHELHWLNVTLACLGRMGATIVLQMVCLVNAELYPTFIRNLGMMVCSALCDLGGIF
TPFMVFRLMEVWQALPLILFGVLGLTAGAMTLLLPETKGVALPETIEEAENLGRRKSKAK
ENTIYLQVQTGKSSST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50170653
NameBDBM50170653
Synonyms:(11beta)-11,21-dihydroxypregn-4-ene-3,20-dione | 11beta,21-dihydroxypregn-4-ene-3,20-dione | 11beta,21-dihydroxyprogesterone | 17-deoxycortisol | CHEMBL110739 | corticosterone
TypeSmall organic molecule
Emp. Form.C21H30O4
Mol. Mass.346.4605
SMILESC[C@]12C[C@H](O)[C@H]3[C@@H](CCC4=CC(=O)CC[C@]34C)[C@@H]1CC[C@@H]2C(=O)CO |r,t:9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a