Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCDK6/G1/S-specific cyclin D3
LigandBDBM50420303
Substrate/Competitorn/a
Meas. Tech.ChEMBL_839770
IC50 300±n/a nM
Citation Cho, YSAngove, HBrain, CChen, CHCheng, HCheng, RChopra, RChung, KCongreve, MDagostin, CDavis, DJFeltell, RGiraldes, JHiscock, SDKim, SKovats, SLagu, BLewry, KLoo, ALu, YLuzzio, MManiara, WMcMenamin, RMortenson, PNBenning, RRees, DCShen, JSmith, TWang, YWilliams, GWoolford, AJWrona, WXu, MYang, FHoward, S Fragment-Based Discovery of 7-Azabenzimidazoles as Potent, Highly Selective, and Orally Active CDK4/6 Inhibitors. ACS Med Chem Lett3:445-449 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CDK6/G1/S-specific cyclin D3
Name:CDK6/G1/S-specific cyclin D3
Synonyms:CDK6/D3 | CDK6/cyclin D3 | Cyclin-dependent kinase 6/G1/S-specific cyclin D3
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 304700
Components:This complex has 2 components.
Component 1
Name:Cyclin-dependent kinase 6
Synonyms:CDK6 | CDKN6 | Cell division protein kinase 6 | Cyclin-dependent kinase 6 (CDK 6) | Serine/threonine-protein kinase PLSTIRE
Type:Enzyme Subunit
Mol. Mass.:36937.42
Organism:Homo sapiens (Human)
Description:Q00534
Residue:326
Sequence:
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:G1/S-specific cyclin-D3
Synonyms:CCND3
Type:Enzyme
Mol. Mass.:32521.90
Organism:Homo sapiens (Human)
Description:P30281
Residue:292
Sequence:
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKML
AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLT
IEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKK
HAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCL
RACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50420303
NameBDBM50420303
Synonyms:CHEMBL2089064 | US8598217, 135
TypeSmall organic molecule
Emp. Form.C28H27N7O
Mol. Mass.477.5603
SMILESCN(C)C1CCN(CC1)c1ccc2[nH]c(nc2n1)C(=O)c1ccnc(c1)-c1cncc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a