Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 13 (MAPK13)
LigandBDBM50420762
Substrate/Competitorn/a
Meas. Tech.ChEMBL_842608
IC50 20±n/a nM
Citation Aiguadé, JBalagué, CCarranco, ICaturla, FDomínguez, MEastwood, PEsteve, CGonzález, JLumeras, WOrellana, APreciado, SRoca, RVidal, LVidal, B Novel triazolopyridylbenzamides as potent and selective p38a inhibitors. Bioorg Med Chem Lett22:3431-6 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 13 (MAPK13)
Name:p38 delta/gamma
Synonyms:MAP kinase p38 delta | Mitogen-activated protein kinase 13 | Mitogen-activated protein kinase p38 | Mitogen-activated protein kinase p38 delta | Stress-activated protein kinase 4
Type:Enzyme
Mol. Mass.:42097.16
Organism:Homo sapiens (Human)
Description:O15264
Residue:365
Sequence:
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50420762
NameBDBM50420762
Synonyms:CHEMBL2087508
TypeSmall organic molecule
Emp. Form.C21H22N4O
Mol. Mass.346.4256
SMILESCc1ccc(cc1-c1ccn2c(nnc2c1)C1CCC1)C(=O)NC1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a