Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM18069
Substrate/Competitorn/a
Meas. Tech.ChEMBL_55248
IC50 450±n/a nM
Citation Roth, BRauckman, BSFerone, RBaccanari, DPChampness, JNHyde, RM 2,4-Diamino-5-benzylpyrimidines as antibacterial agents. 7. Analysis of the effect of 3,5-dialkyl substituent size and shape on binding to four different dihydrofolate reductase enzymes. J Med Chem30:348-56 (1987) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:17729.84
Organism:Neisseria gonorrhoeae
Description:ChEMBL_55248
Residue:162
Sequence:
MLKITIIAACAENLCIGAGNAMPWHIPEDFAFFKVYTLGKPVIMGRKTWESLPVKPLPGR
RNIVISRQADYCAAGAETVASLEVALALCAGAEEAVIMGGAQIYGQAMPLATDLRITEVD
LSVEGDAFFPEIDRTHWREAERTERRVSSKGVAYTFVHYLGK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18069
NameBDBM18069
Synonyms:5-[(3,4,5-trimethoxyphenyl)methyl]pyrimidine-2,4-diamine | CHEMBL22 | TMP | Trimethoprim | Trimethoprim (TMP)
TypeSmall organic molecule
Emp. Form.C14H18N4O3
Mol. Mass.290.3177
SMILESCOc1cc(Cc2cnc(N)nc2N)cc(OC)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a