Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclooxygenase-2 (COX-2)
LigandBDBM50422589
Substrate/Competitorn/a
Meas. Tech.ChEMBL_307272
IC50 204174±n/a nM
Citation Prasanna, SManivannan, EChaturvedi, SC Quantitative structure-activity relationship analysis of a series of 2,3-diaryl benzopyran analogues as novel selective cyclooxygenase-2 inhibitors. Bioorg Med Chem Lett14:4005-11 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclooxygenase-2 (COX-2)
Name:Prostaglandin G/H synthase (cyclooxygenase)
Synonyms:Cyclooxygenase-2 | Glucocorticoid-regulated inflammatory cyclooxygenase | Gripghs | Macrophage activation-associated marker protein P71/73 | PES-2 | PGH synthase 2 | PGHS-2 | PHS II | Prostaglandin G/H synthase (cyclooxygenase) | Prostaglandin H2 synthase 2 | Prostaglandin-endoperoxide synthase 2 | TIS10 protein
Type:Protein
Mol. Mass.:69020.39
Organism:Mus musculus (Mouse)
Description:Q05769
Residue:604
Sequence:
MLFRAVLLCAALGLSQAANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSLIMKYVLTSRSYLIDSPPTYNVHY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGS
NMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKY
QVIGGEVYPPTVKDTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCD
ILKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIAGRV
AGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKAL
YSDIDVMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTSFNVQDPQPTKTATINASASHSRLDDINPTVLIKRR
STEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50422589
NameBDBM50422589
Synonyms:CHEMBL134512
TypeSmall organic molecule
Emp. Form.C22H15FO4S
Mol. Mass.394.416
SMILESCS(=O)(=O)c1ccc(cc1)-c1oc2ccccc2c(=O)c1-c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a