Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1A
LigandBDBM50423462
Substrate/Competitorn/a
Meas. Tech.ChEMBL_461998
Kd 28±n/a nM
Citation Troxler, TEnz, AHoyer, DLangenegger, DNeumann, PPfäffli, PSchoeffter, PHurth, K Ergoline derivatives as highly potent and selective antagonists at the somatostatin sst 1 receptor. Bioorg Med Chem Lett18:979-82 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1A
Name:Dopamine D2 receptor and serotonin 1a receptor
Synonyms:5-HT-1A | 5-HT1A | 5-hydroxytryptamine receptor 1A (5-HT-1A) | ADRB2RL1 | ADRBRL1 | G-21 | HTR1A | Serotonin receptor 1A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46122.49
Organism:Homo sapiens (human)
Description:Human 5-HT1A serotonin receptors stably expressed in HEK-293 cells.
Residue:422
Sequence:
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50423462
NameBDBM50423462
Synonyms:CHEMBL251835
TypeSmall organic molecule
Emp. Form.C26H27BrN6O2
Mol. Mass.535.436
SMILESCN1C[C@@H](C[C@H]2[C@H]1Cc1c(Br)[nH]c3cccc2c13)C(=O)N1CCN(CC1)c1ccc2nonc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a