Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMultidrug and toxin extrusion protein 2
LigandBDBM50424712
Substrate/Competitorn/a
Meas. Tech.ChEMBL_934318
IC50 12700±n/a nM
Citation Wittwer, MBZur, AAKhuri, NKido, YKosaka, AZhang, XMorrissey, KMSali, AHuang, YGiacomini, KM Discovery of potent, selective multidrug and toxin extrusion transporter 1 (MATE1, SLC47A1) inhibitors through prescription drug profiling and computational modeling. J Med Chem56:781-95 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Multidrug and toxin extrusion protein 2
Name:Multidrug and toxin extrusion protein 2
Synonyms:Kidney-specific H(+)/organic cation antiporter | MATE-2 | MATE2 | SLC47A2 | Solute carrier family 47 member 2 | hMATE-2
Type:PROTEIN
Mol. Mass.:65098.38
Organism:Homo sapiens (Human)
Description:ChEMBL_934314
Residue:602
Sequence:
MDSLQDTVALDHGGCCPALSRLVPRGFGTEMWTLFALSGPLFLFQVLTFMIYIVSTVFCG
HLGKVELASVTLAVAFVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQRGALVLL
LCCLPCWALFLNTQHILLLFRQDPDVSRLTQDYVMIFIPGLPVIFLYNLLAKYLQNQGWL
KGQEEESPFQTPGLSILHPSHSHLSRASFHLFQKITWPQVLSGVVGNCVNGVANYALVSV
LNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWSSQCLQDWGPFFSLAVPSML
MICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMIPLGLSIGVCVRVGMALGAAD
TVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVF
EAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFL
ATAAFVAYTARLDWKLAAEEAKKHSGRQQQQRAESTATRPGPEKAVLSSVATGSSPGITL
TTYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMVGLTVRILAT
RH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50424712
NameBDBM50424712
Synonyms:CAMOSTAT | Camostat Mesilate | Foipan
TypeSmall organic molecule
Emp. Form.C20H22N4O5
Mol. Mass.398.4125
SMILES[#6]-[#7](-[#6])-[#6](=O)-[#6]-[#8]-[#6](=O)-[#6]-c1ccc(-[#8]-[#6](=O)-c2ccc(cc2)\[#7]=[#6](\[#7])-[#7])cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a