Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMultidrug and toxin extrusion protein 2
LigandBDBM50001859
Substrate/Competitorn/a
Meas. Tech.ChEMBL_934318
IC50 46000±n/a nM
Citation Wittwer, MBZur, AAKhuri, NKido, YKosaka, AZhang, XMorrissey, KMSali, AHuang, YGiacomini, KM Discovery of potent, selective multidrug and toxin extrusion transporter 1 (MATE1, SLC47A1) inhibitors through prescription drug profiling and computational modeling. J Med Chem56:781-95 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Multidrug and toxin extrusion protein 2
Name:Multidrug and toxin extrusion protein 2
Synonyms:Kidney-specific H(+)/organic cation antiporter | MATE-2 | MATE2 | SLC47A2 | Solute carrier family 47 member 2 | hMATE-2
Type:PROTEIN
Mol. Mass.:65098.38
Organism:Homo sapiens (Human)
Description:ChEMBL_934314
Residue:602
Sequence:
MDSLQDTVALDHGGCCPALSRLVPRGFGTEMWTLFALSGPLFLFQVLTFMIYIVSTVFCG
HLGKVELASVTLAVAFVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQRGALVLL
LCCLPCWALFLNTQHILLLFRQDPDVSRLTQDYVMIFIPGLPVIFLYNLLAKYLQNQGWL
KGQEEESPFQTPGLSILHPSHSHLSRASFHLFQKITWPQVLSGVVGNCVNGVANYALVSV
LNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWSSQCLQDWGPFFSLAVPSML
MICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMIPLGLSIGVCVRVGMALGAAD
TVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVF
EAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFL
ATAAFVAYTARLDWKLAAEEAKKHSGRQQQQRAESTATRPGPEKAVLSSVATGSSPGITL
TTYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMVGLTVRILAT
RH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001859
NameBDBM50001859
Synonyms:(buspirone) 8-[4-(4-Pyrimidin-2-yl-piperazin-1-yl)-butyl]-8-aza-spiro[4.5]decane-7,9-dione | 8-[4-(4-Pyrimidin-2-yl-piperazin-1-yl)-butyl]-8-aza-spiro[4.5]decane-7,9-dione : (Hydrochloride) | 8-[4-(4-Pyrimidin-2-yl-piperazin-1-yl)-butyl]-8-aza-spiro[4.5]decane-7,9-dione; Hydrochloride(Buspirone) | 8-[4-(4-pyrimidin-2-yl-piperazin-1-yl)-butyl]-8-aza-spiro[4.5]decane-7,9-dione | BUSPAR | BUSPIRONE | CHEMBL49
TypeSmall organic molecule
Emp. Form.C21H31N5O2
Mol. Mass.385.5031
SMILESO=C1CC2(CCCC2)CC(=O)N1CCCCN1CCN(CC1)c1ncccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a