Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLactate dehydrogenase A (LDHA)
LigandBDBM50425798
Substrate/Competitorn/a
Meas. Tech.ChEMBL_937556
IC50 220±n/a nM
Citation Kohlmann, AZech, SGLi, FZhou, TSquillace, RMCommodore, LGreenfield, MTLu, XMiller, DPHuang, WSQi, JThomas, RMWang, YZhang, SDodd, RLiu, SXu, RXu, YMiret, JJRivera, VClackson, TShakespeare, WCZhu, XDalgarno, DC Fragment growing and linking lead to novel nanomolar lactate dehydrogenase inhibitors. J Med Chem56:1023-40 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lactate dehydrogenase A (LDHA)
Name:L-lactate dehydrogenase A chain
Synonyms:Cell proliferation-inducing gene 19 protein | L-lactate dehydrogenase A | L-lactate dehydrogenase A Chain | LDH muscle subunit | LDH-A | LDH-M | Renal carcinoma antigen NY-REN-59
Type:Protein
Mol. Mass.:36694.85
Organism:Homo sapiens (Human)
Description:P00338::PDB Code: 4ajp
Residue:332
Sequence:
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG
EMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI
IPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
HPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYE
VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI
SDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50425798
NameBDBM50425798
Synonyms:CHEMBL2316886
TypeSmall organic molecule
Emp. Form.C33H31ClFN3O12S
Mol. Mass.748.129
SMILESCOc1cc(OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)COc2cc(F)cc(c2)-c2ccc(cn2)C(O)=O)c(Cl)cc1NC(=O)CSc1ccc(cn1)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a