Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApoptosis regulator Bcl-2
LigandBDBM50427830
Substrate/Competitorn/a
Meas. Tech.ChEMBL_940709
IC50 0.900000±n/a nM
Citation Aguilar, AZhou, HChen, JLiu, LBai, LMcEachern, DYang, CYMeagher, JStuckey, JWang, S A potent and highly efficacious Bcl-2/Bcl-xL inhibitor. J Med Chem56:3048-67 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Apoptosis regulator Bcl-2
Name:Apoptosis regulator Bcl-2
Synonyms:Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | Bcl-2 Protein
Type:Homodimer or heterodimer
Mol. Mass.:26269.11
Organism:Homo sapiens (Human)
Description:P10415
Residue:239
Sequence:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50427830
NameBDBM50427830
Synonyms:CHEMBL2325766
TypeSmall organic molecule
Emp. Form.C48H53ClN8O7S3
Mol. Mass.985.632
SMILESCN(C)CC[C@H](CSc1ccccc1)Nc1ccc(cc1[N+]([O-])=O)S(=O)(=O)Nc1ccc(cc1)N1CCN(CC1)c1cccc(c1)-c1c(C(=O)NS(C)(=O)=O)c(C)n(C)c1-c1ccc(Cl)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a