Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-cysteine N-palmitoyltransferase porcupine
LigandBDBM50428029
Substrate/Competitorn/a
Meas. Tech.ChEMBL_941167
EC50 60±n/a nM
Citation Wang, XMoon, JDodge, MEPan, XZhang, LHanson, JMTuladhar, RMa, ZShi, HWilliams, NSAmatruda, JFCarroll, TJLum, LChen, C The development of highly potent inhibitors for porcupine. J Med Chem56:2700-4 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-cysteine N-palmitoyltransferase porcupine
Name:Protein-cysteine N-palmitoyltransferase porcupine
Synonyms:2.3.1.- | Porc | Porcn | Ppn | mPORC
Type:PROTEIN
Mol. Mass.:52528.36
Organism:Mus musculus
Description:ChEMBL_941167
Residue:461
Sequence:
MATFSRQEFFQQLLQGCLLPTVQQGLDQIWLLLTICFACRLLWRLGLPSYLKHASTVAGG
FFSLYHFFQLHMVWVVLLSLLCYLVLFLCRHSSHRGVFLSVTILIYLLMGEMHMVDTVTW
HKMRGAQMIVAMKAVSLGFDLDRGEVGAVPSPVEFMGYLYFVGTIVFGPWISFHSYLQAV
QGRPLSRRWLKKVARSLALALLCLVLSTCVGPYLFPYFIPLDGDRLLRNKKRKARGTMVR
WLRAYESAVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSRPLNVELPRSMVE
VVTSWNLPMSYWLNNYVFKNALRLGTFSAVLVTYAASALLHGFSFHLAAVLLSLAFITYV
EHVLRKRLAQILSACILSKRCLPDCSHRHRLGLGVRALNLLFGALAIFHLSYLGSLFDVD
VDDTTEEQGYGMAYTVHKWSELSWASHWVTFGCWIFYRLIG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50428029
NameBDBM50428029
Synonyms:CHEMBL1257063
TypeSmall organic molecule
Emp. Form.C26H21N5O5S
Mol. Mass.515.54
SMILESCOc1ccc(cc1)-n1nc(C(=O)NCC(=O)Nc2nc3ccc(OC)cc3s2)c2ccccc2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a