Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEphrin type-A receptor 2
LigandBDBM50428059
Substrate/Competitorn/a
Meas. Tech.ChEMBL_941272
IC50 12000±n/a nM
Citation Incerti, MTognolini, MRusso, SPala, DGiorgio, CHassan-Mohamed, INoberini, RPasquale, EBVicini, PPiersanti, SRivara, SBarocelli, EMor, MLodola, A Amino acid conjugates of lithocholic acid as antagonists of the EphA2 receptor. J Med Chem56:2936-47 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ephrin type-A receptor 2
Name:Ephrin type-A receptor 2
Synonyms:ECK | EPHA2 | Epithelial cell kinase | Tyrosine-protein kinase receptor ECK
Type:PROTEIN
Mol. Mass.:108260.70
Organism:Homo sapiens (Human)
Description:ChEMBL_1505248
Residue:976
Sequence:
MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMN
DMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL
AFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGG
EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPS
PEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDI
VYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG
LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSN
SYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGG
VAVGVVLLLVLAGVGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQA
VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDF
LGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGML
RGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIP
IRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM
DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSG
SEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAY
SLLGLKDQVNTVGIPI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50428059
NameBDBM50428059
Synonyms:CHEMBL2322989
TypeSmall organic molecule
Emp. Form.C35H50N2O4
Mol. Mass.562.7825
SMILESC[C@H](CCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(O)=O)[C@H]1CC[C@H]2[C@@H]3CC[C@@H]4C[C@H](O)CC[C@]4(C)[C@H]3CC[C@]12C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a