Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5'-AMP-activated protein kinase subunit beta-1
LigandBDBM50429867
Substrate/Competitorn/a
Meas. Tech.ChEMBL_944294
IC50>10000±n/a nM
Citation Takeuchi, CSKim, BGBlazey, CMMa, SJohnson, HWAnand, NKArcalas, ABaik, TGBuhr, CACannoy, JEpshteyn, SJoshi, ALara, KLee, MSWang, LLeahy, JWNuss, JMAay, NAoyama, RFoster, PLee, JLehoux, IMunagala, NPlonowski, ARajan, SWoolfrey, JYamaguchi, KLamb, PMiller, N Discovery of a novel class of highly potent, selective, ATP-competitive, and orally bioavailable inhibitors of the mammalian target of rapamycin (mTOR). J Med Chem56:2218-34 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5'-AMP-activated protein kinase subunit beta-1
Name:5'-AMP-activated protein kinase subunit beta-1
Synonyms:5'-AMP-activated protein kinase subunit beta-1 (AMPK) | 5''''''''-AMP-activated protein kinase subunit beta-1 | 5''''-AMP-activated protein kinase catalytic subunit alpha-2/beta-1/gamma-2 | 5''''-AMP-activated protein kinase subunit beta-1 | 5''-AMP-activated protein kinase subunit beta-1 | AMP-activated protein kinase, beta-1 subunit | AMPK | AMPK subunit beta-1 | AMPKb | PRKAB1
Type:n/a
Mol. Mass.:30380.94
Organism:Homo sapiens (Human)
Description:Q9Y478
Residue:270
Sequence:
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429867
NameBDBM50429867
Synonyms:CHEMBL2333365
TypeSmall organic molecule
Emp. Form.C23H22FN3O4S
Mol. Mass.455.502
SMILESCc1c(F)c(ccc1C(=O)N1CCOc2ccc(cc2C1)-c1ccc(N)nc1)S(C)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a