Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcid ceramidase (AC)
LigandBDBM29080
Substrate/Competitorn/a
Meas. Tech.ChEMBL_949260
Ki 500000±n/a nM
Citation Pizzirani, DPagliuca, CRealini, NBranduardi, DBottegoni, GMor, MBertozzi, FScarpelli, RPiomelli, DBandiera, T Discovery of a new class of highly potent inhibitors of acid ceramidase: synthesis and structure-activity relationship (SAR). J Med Chem56:3518-30 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acid ceramidase (AC)
Name:Acid ceramidase
Synonyms:Acid ceramidase
Type:Enzyme
Mol. Mass.:44662.65
Organism:Homo sapiens (Human)
Description:Q13510
Residue:395
Sequence:
MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYK
RWHELMLDKAPVLKVIVNSLKNMINTFVPSGKIMQVVDEKLPGLLGNFPGPFEEEMKGIA
AVTDIPLGEIISFNIFYELFTICTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITE
QLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWI
LGKKDVMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKE
SLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLST
KPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29080
NameBDBM29080
Synonyms:CHEMBL280065 | N-oleoylethanolamine | Oleamide MEA | Oleoyl monoethanolamide | Oleoylethanolamide (OEA)
Typen/a
Emp. Form.C20H39NO2
Mol. Mass.325.5292
SMILESCCCCCCCC\C=C/CCCCCCCC(=O)NCCO
Structure
n/a