Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFocal adhesion kinase 1/vascular endothelial growth factor receptor 3
LigandBDBM50430297
Substrate/Competitorn/a
Meas. Tech.ChEMBL_952664
IC50>30000±n/a nM
Citation Iwatani, MIwata, HOkabe, ASkene, RJTomita, NHayashi, YAramaki, YHosfield, DJHori, ABaba, AMiki, H Discovery and characterization of novel allosteric FAK inhibitors. Eur J Med Chem61:49-60 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Focal adhesion kinase 1/vascular endothelial growth factor receptor 3
Name:Focal adhesion kinase 1/vascular endothelial growth factor receptor 3
Synonyms:FADK 1 | FLT4 | Focal adhesion kinase (FAK) | Focal adhesion kinase (PTK2) | Focal adhesion kinase 1 | Focal adhesion kinase 1 (FADK 1) (pp125FAK) (Protein-tyrosine kinase 2). | Focal adhesion kinase 1 (FAK) | PTK2 | PTK2 protein tyrosine kinase 2 | Protein phosphatase 1 regulatory subunit 71 | Protein-tyrosine kinase 2 | Protein-tyrosine kinase 2 (PTK2) | Tyrosine Kinase FAK | Vascular endothelial growth factor receptor 3 (VEGFR3) | pp125FAK
Type:Tyrosine-protein kinase
Mol. Mass.:119233.17
Organism:Homo sapiens (human)
Description:n/a
Residue:1052
Sequence:
MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQE
IAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNE
GVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA
LRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQM
LTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50430297
NameBDBM50430297
Synonyms:CHEMBL2333436
TypeSmall organic molecule
Emp. Form.C20H21N3O2S
Mol. Mass.367.465
SMILESCCc1ccc(cc1)-c1ccc2N(C)S(=O)(=O)c3cnn(CC)c3-c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a