Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMyeloperoxidase (MPO)
LigandBDBM50432582
Substrate/Competitorn/a
Meas. Tech.ChEMBL_950697
IC50 29±n/a nM
Citation Soubhye, JAldib, IElfving, BGelbcke, MFurtmüller, PGPodrecca, MConotte, RColet, JMRousseau, AReye, FSarakbi, AVanhaeverbeek, MKauffmann, JMObinger, CNève, JPrévost, MZouaoui Boudjeltia, KDufrasne, FVan Antwerpen, P Design, synthesis, and structure-activity relationship studies of novel 3-alkylindole derivatives as selective and highly potent myeloperoxidase inhibitors. J Med Chem56:3943-58 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Myeloperoxidase (MPO)
Name:Myeloperoxidase
Synonyms:84 kDa myeloperoxidase | 89 kDa myeloperoxidase | MPO | Mpo protein | Myeloperoxidase | Myeloperoxidase heavy chain | Myeloperoxidase light chain
Type:Enzyme
Mol. Mass.:83888.32
Organism:Homo sapiens (Human)
Description:P05164
Residue:745
Sequence:
MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTS
LVLSSMEEAKQLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLH
VALDLLERKLRSLWRRPFNVTDVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMC
NNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTD
QLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPND
PRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQL
GLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLL
REHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYR
SYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLE
GGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYN
AWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPL
LACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMS
NSYPRDFVNCSTLPALNLASWREAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50432582
NameBDBM50432582
Synonyms:CHEMBL205229
TypeSmall organic molecule
Emp. Form.C10H11FN2
Mol. Mass.178.2061
SMILESNCCc1c[nH]c2c(F)cccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a