Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoacylglycerol acyltransferase type 2 (h-MGAT2)
LigandBDBM50433276
Substrate/Competitorn/a
Meas. Tech.ChEMBL_957858
IC50 1.6±n/a nM
Citation Barlind, JGBuckett, LKCrosby, SGDavidsson, Emtenäs, HErtan, AJurva, ULemurell, MGutierrez, PMNilsson, KO'Mahony, GPetersson, AURedzic, AWågberg, FYuan, ZQ Identification and design of a novel series of MGAT2 inhibitors. Bioorg Med Chem Lett23:2721-6 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoacylglycerol acyltransferase type 2 (h-MGAT2)
Name:Monoacylglycerol acyltransferase type 2 (h-MGAT2)
Synonyms:Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase | Beta-1,2-N-acetylglucosaminyltransferase II | GNT-II | GlcNAc-T II | MGAT2 | Mannoside acetylglucosaminyltransferase 2 | Monoacylglycerol acyltransferase 2 (MGAT2) | N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase II | h-MGAT2 (human monoacylglycerol acyltransferase type 2)
Type:n/a
Mol. Mass.:51567.80
Organism:Homo sapiens (Human)
Description:Q10469
Residue:447
Sequence:
MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNEALAPPLLDAEPARGAGGRGGDHPSV
AVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVL
VVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTEINQLIAGVNFCPVLQVFFPFS
IQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHF
VWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF
YGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLTVSCLPK
FWKVLVPQIPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTVV
AISPPRKNGGWGDIRDHELCKSYRRLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50433276
NameBDBM50433276
Synonyms:CHEMBL2376316
TypeSmall organic molecule
Emp. Form.C19H21F2N3O3S
Mol. Mass.409.45
SMILESCCC1(CC)CNc2ccc(cc2C(=O)N1)S(=O)(=O)Nc1ccc(F)cc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a